PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 177aa    MW: 19994.1 Da    PI: 8.2845
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021438genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94.2e-4471061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC++dCv+apyfp +qp+kfanvhk+FGasnv kll++l++ +reda++sl+yeA+ar+rdPvyG+vg+i+ lq ql+q++ +l  +k
  DCAR_021438   7 RCAACKFLRRKCSQDCVFAPYFPPDQPQKFANVHKVFGASNVAKLLNDLRPVQREDAVNSLAYEADARLRDPVYGCVGLISILQDQLKQVQGDLINAK 104
                  6******************************************************************************************9998887 PP

       DUF260  99 ee 100
                  +e
  DCAR_021438 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8996107IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-437103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSSSNSRCAA CKFLRRKCSQ DCVFAPYFPP DQPQKFANVH KVFGASNVAK LLNDLRPVQR  60
EDAVNSLAYE ADARLRDPVY GCVGLISILQ DQLKQVQGDL INAKKELANY RTSAVLPYNM  120
LPMLGLCLNQ DHGAMPLVMH DHPQKQHLME AQQLAVAEWE QQEMLRPCKQ EQQRRV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491765.12e-71PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-62LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-72A0A0B0PS92_G
STRINGVIT_00s1247g00010.t015e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-63ASYMMETRIC LEAVES 2-like 1